Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-1ra protein

The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152) ) (Gene ID: 100034236) .

Product Specifications

Product Name Alternative

IL-1F3

Source

Yeast

Origin

Equine

Purity

98%

Form

Lyophilized

Molecular Weight

17.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ (152)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG5 Rabbit Polyclonal Antibody
TA381778 100 µL

SMG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM6 Rabbit Polyclonal Antibody
ER1902-54 100 µL

CEACAM6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BACE1 (NM_138971) Human Over-expression Lysate
LY430074 100 µg

BACE1 (NM_138971) Human Over-expression Lysate

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL
BNCB1620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Pcp2 activation kit by CRISPRa
GA203122 1 Kit

Mouse Pcp2 activation kit by CRISPRa

Sign In for Pricing
View Details
TMEM200A (NM_052913) Human Over-expression Lysate
LC403269 20 µg

TMEM200A (NM_052913) Human Over-expression Lysate

Sign In for Pricing
View Details