Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL-13 protein

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) ) (Gene ID: 3596) .

Product Specifications

Source

Yeast

Origin

Human

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TRABD2B shRNA (UAS) - Lentiviral human TRABD2B shRNA (UAS) (100)
GTR15125586 1 Vial

Lentiviral human TRABD2B shRNA (UAS) - Lentiviral human TRABD2B shRNA (UAS) (100)

Sign In for Pricing
View Details
MUCL1 Protein Vector (Mouse) (pPM-C-His)
PV203017 500 ng

MUCL1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MMP2-IN-1
BA3092-10 10 mg

MMP2-IN-1

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE)
MBS6184035-01 0.1 mL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE)

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE)
MBS6184035-02 5x 0.1 mL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE)

Sign In for Pricing
View Details
BDKRB2 Antibody, FITC conjugated
CSB-PA002652LC01HU-01 50 µg

BDKRB2 Antibody, FITC conjugated

Sign In for Pricing
View Details