Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL-13 protein

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) ) (Gene ID: 3596) .

Product Specifications

Source

Yeast

Origin

Human

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1A1 Rabbit Polyclonal Antibody (HRP)
orb2085071 100 µL

RBMY1A1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Decarboxylated S-adenosylmethionine sulfate
SCA38081 0.5 mg

Decarboxylated S-adenosylmethionine sulfate

Sign In for Pricing
View Details
STAT3 Antibody
MBS9504275-01 0.05 mL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
MBS9504275-02 0.1 mL

STAT3 Antibody

Sign In for Pricing
View Details
STAT3 Antibody
MBS9504275-03 5x 0.1 mL

STAT3 Antibody

Sign In for Pricing
View Details
5'-O-DMTr-2'-O-TOM-rA (Ac)
NS182-1 1 g

5'-O-DMTr-2'-O-TOM-rA (Ac)

Sign In for Pricing
View Details