Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea pig TGF alpha protein

The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158) .

Product Specifications

Source

Yeast

Origin

Guinea Pig

Field of Research

Neuroscience

Purity

98%

Form

Lyophilized

Molecular Weight

5.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1555R) [PE]
NBP2-54424PE 100 µL

Rabbit Monoclonal EpCAM/TROP1 Antibody (EGP40/1555R) [PE]

Sign In for Pricing
View Details
Mouse Monoclonal Haptoglobin Antibody (HP/4815) [DyLight 350]
NBP3-26949UV 0.1 mL

Mouse Monoclonal Haptoglobin Antibody (HP/4815) [DyLight 350]

Sign In for Pricing
View Details
Lentiviral human SNAPC2 shRNA (UAS) - Lentiviral human SNAPC2 shRNA (UAS, RFP) (25)
GTR15085427 1 Vial

Lentiviral human SNAPC2 shRNA (UAS) - Lentiviral human SNAPC2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
QRFP-43 (Rat) - I-125 Labeled
T-049-60 10 µCi

QRFP-43 (Rat) - I-125 Labeled

Sign In for Pricing
View Details
Alpha 5 beta 1 Integrin Antibody [M200 (Volociximab) ], Rabbit IgG - Research Grade Biosimilar
24-391 0.2 mg

Alpha 5 beta 1 Integrin Antibody [M200 (Volociximab) ], Rabbit IgG - Research Grade Biosimilar

Sign In for Pricing
View Details
2- (1-Methylcyclopropyl) benzaldehyde
OR1085687-01 250 mg

2- (1-Methylcyclopropyl) benzaldehyde

Sign In for Pricing
View Details