Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea pig TGF alpha protein

The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158) .

Product Specifications

Source

Yeast

Origin

Guinea Pig

Field of Research

Neuroscience

Purity

98%

Form

Lyophilized

Molecular Weight

5.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-01 10 µg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-02 50 µg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-03 100 µg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-04 200 µg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-05 500 µg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details
Recombinant Tankyrase 1 (TNKS1)
TRV-0009871-06 1 mg

Recombinant Tankyrase 1 (TNKS1)

Sign In for Pricing
View Details