Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guinea pig TGF alpha protein

The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158) .

Product Specifications

Source

Yeast

Origin

Guinea Pig

Field of Research

Neuroscience

Purity

98%

Form

Lyophilized

Molecular Weight

5.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-Glutamate [NMDA] receptor subunit epsilon-3 antibody ELISA kit
GTR10411890 96 Well

Human anti-Glutamate [NMDA] receptor subunit epsilon-3 antibody ELISA kit

Sign In for Pricing
View Details
Olr374 Protein Vector (Rat) (pPM-C-HA)
PV289824 500 ng

Olr374 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
EAAT2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-25574R-BF750 100 µL

EAAT2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Eps8L1 Lentiviral Activation Particles (m)
sc-426552-LAC 200 µL

Eps8L1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 4 ELISA Kit
MBS763616-01 48 Well

Rat Fibroblast Growth Factor 4 ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 4 ELISA Kit
MBS763616-02 96 Well

Rat Fibroblast Growth Factor 4 ELISA Kit

Sign In for Pricing
View Details