Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline M-CSF protein

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158) ) (Gene ID: 101091467) .

Product Specifications

Source

Yeast

Origin

Feline

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

18.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARL5C activation kit by CRISPRa
GA118175 1 Kit

Human ARL5C activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708013 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
hnRNP U (HNRNPU) (NM_004501) Human Over-expression Lysate
LY401431 100 µg

hnRNP U (HNRNPU) (NM_004501) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF647 conjugate, 0.1mg/mL
BNC473776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR51B2 Human Gene Knockout Kit (CRISPR)
KN422213 1 Kit

OR51B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP-GloTM Bioluminometric Cell Viability Assay Kit (200 assays)
#30020-1 1 Kit

ATP-GloTM Bioluminometric Cell Viability Assay Kit (200 assays)

Sign In for Pricing
View Details