Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline M-CSF protein

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158) ) (Gene ID: 101091467) .

Product Specifications

Source

Yeast

Origin

Feline

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

18.4 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neem Oil
TRC-N388920-500G 500 g

Neem Oil

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (rAE-4), CF647 conjugate, 0.1mg/mL
BNC473518-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ku80 (XRCC5) Rabbit Polyclonal Antibody
AP06208PU-N 100 µg

Ku80 (XRCC5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit
E-UNEL-M0197-01 5x 96 Tests

Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit
E-UNEL-M0197-02 15x 96 Tests

Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit

Sign In for Pricing
View Details
IRS1 pSer639 Rabbit Polyclonal Antibody
AP02489PU-S 50 µL

IRS1 pSer639 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details