Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate IFN beta protein

The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166) ) (Gene ID: 100598986) .

Product Specifications

Source

Yeast

Origin

Gibbon

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

20.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kadsurenin B
T79948-01 5 mg

Kadsurenin B

Sign In for Pricing
View Details
Kadsurenin B
T79948-02 50 mg

Kadsurenin B

Sign In for Pricing
View Details
Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit
abx155760-01 96 Tests

Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit

Sign In for Pricing
View Details
Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit
abx155760-02 5x 96 Tests

Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit

Sign In for Pricing
View Details
Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit
abx155760-03 10x 96 Tests

Rat Proliferation Marker Protein Ki-67 (MKI67) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human C1q Protein, Untagged, Native Protein-200ug
QP11228-200ug 200ug

Recombinant Human C1q Protein, Untagged, Native Protein-200ug

Sign In for Pricing
View Details