Primate IFN beta protein

The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166) ) (Gene ID: 100598986) .