Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IL-2 protein

The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) .

Product Specifications

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Rhodamine)
P3113-96Z5 100 µL

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Rhodamine)

Sign In for Pricing
View Details
FBXL12, CT (FBXL12, FBL12, F-box/LRR-repeat protein 12, F-box and leucine-rich repeat protein 12, F-box protein FBL12) (MaxLight 550)
MBS6298226-01 0.1 mL

FBXL12, CT (FBXL12, FBL12, F-box/LRR-repeat protein 12, F-box and leucine-rich repeat protein 12, F-box protein FBL12) (MaxLight 550)

Sign In for Pricing
View Details
FBXL12, CT (FBXL12, FBL12, F-box/LRR-repeat protein 12, F-box and leucine-rich repeat protein 12, F-box protein FBL12) (MaxLight 550)
MBS6298226-02 5x 0.1 mL

FBXL12, CT (FBXL12, FBL12, F-box/LRR-repeat protein 12, F-box and leucine-rich repeat protein 12, F-box protein FBL12) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Cytochrome b6 (petB)
MBS7025709-01 0.02 mg

Recombinant Microcystis aeruginosa Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Cytochrome b6 (petB)
MBS7025709-02 0.1 mg

Recombinant Microcystis aeruginosa Cytochrome b6 (petB)

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa Cytochrome b6 (petB)
MBS7025709-03 5x 0.1 mg

Recombinant Microcystis aeruginosa Cytochrome b6 (petB)

Sign In for Pricing
View Details