Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IL-2 protein

The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) .

Product Specifications

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ece1 3'UTR GFP Stable Cell Line
TU155573 1.0 mL

Ece1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TNF Receptor I/TNFRSF1A Rabbit Polyclonal Antibody (PE)
orb2610739 100 µg

TNF Receptor I/TNFRSF1A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Raf1 Antibody / c-Raf
F54084-0.05ML 0.05 mL

Raf1 Antibody / c-Raf

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2029951-01 0.01 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2029951-02 0.05 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Sign In for Pricing
View Details
Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2029951-03 0.1 mg

Recombinant Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Sign In for Pricing
View Details