Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ferret IFN Beta protein

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166) ) (Gene ID: 101679100) .

Product Specifications

Source

Yeast

Origin

Ferret

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuropeptide AF (huNPAF) (Human) - Rhodamine Labeled Purified IgG
FR-G-048-40 100 µL

Neuropeptide AF (huNPAF) (Human) - Rhodamine Labeled Purified IgG

Sign In for Pricing
View Details
MED7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28319111 3x 1.0 µg

MED7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TNFRSF13B/TACI, BioAssayTM ELISA Kit (Mouse)
353080 96 Tests

TNFRSF13B/TACI, BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
CD326 monoclonal antibody
orb1677253-01 50 µL

CD326 monoclonal antibody

Sign In for Pricing
View Details
CD326 monoclonal antibody
orb1677253-02 100 µL

CD326 monoclonal antibody

Sign In for Pricing
View Details
CD326 monoclonal antibody
orb1677253-03 200 µL

CD326 monoclonal antibody

Sign In for Pricing
View Details