Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ferret IFN Beta protein

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166) ) (Gene ID: 101679100) .

Product Specifications

Source

Yeast

Origin

Ferret

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KAT6B-MORF Antibody (8C8D12)
NBP3-27150-0.1mL 0.1 mL

Mouse Monoclonal KAT6B-MORF Antibody (8C8D12)

Sign In for Pricing
View Details
R4300-75X110/I Desktop Printer & Applicator Open Core Ribbons
800732 1 Box (1 Ribbon (s) x 1 Piece)

R4300-75X110/I Desktop Printer & Applicator Open Core Ribbons

Sign In for Pricing
View Details
Rps11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7028106 1.0 µg DNA

Rps11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PCMV-EGFP-HK1-Neo Plasmid
PVT75860 2 µg

PCMV-EGFP-HK1-Neo Plasmid

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide-Related Sequence B
orb1905960-01 10 µg

Recombinant Human MHC Class I Polypeptide-Related Sequence B

Sign In for Pricing
View Details
Recombinant Human MHC Class I Polypeptide-Related Sequence B
orb1905960-02 100 µg

Recombinant Human MHC Class I Polypeptide-Related Sequence B

Sign In for Pricing
View Details