Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ferret IFN Beta protein

The Ferret IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ferret IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Ferret IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Ferret IFN beta Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166) ) (Gene ID: 101679100) .

Product Specifications

Source

Yeast

Origin

Ferret

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFKIPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLEEILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKLTDSLPN (166)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd14 3'UTR Luciferase Stable Cell Line
TU103448 1.0 mL

Cd14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Pepstatin A
MBS133327 Inquire

Pepstatin A

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF488A conjugate, 0.1mg/mL
BNC882701-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SOX9 Protein, N-His
YHE57601-01 100 µg

Recombinant Human SOX9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SOX9 Protein, N-His
YHE57601-02 1 mg

Recombinant Human SOX9 Protein, N-His

Sign In for Pricing
View Details
Anti-ERV31/ERV3-1 Antibody Picoband® Fluoro594 Conjugated
RP1091-Fluoro594 100 µg/Vial

Anti-ERV31/ERV3-1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details