Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL11 protein

The Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 (Eotaxin-1) Biotinylated applications are for cell culture. Bovine CCL11 (Eotaxin-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 (Eotaxin-1) Biotinylated Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072) .

Product Specifications

Product Name Alternative

Eotaxin-1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Phosphofructo-2-Kinase Antibody
8C10151-AAT 50 µg

6-Phosphofructo-2-Kinase Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF568 conjugate, 0.1mg/mL
BNC681492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit
E-CL-M0374-01 24 Tests

Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit

Sign In for Pricing
View Details
Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit
E-CL-M0374-02 48 Tests

Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit

Sign In for Pricing
View Details
Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit
E-CL-M0374-03 96 Tests

Mouse HSP-60 (Heat Shock Protein 60) CLIA Kit

Sign In for Pricing
View Details
4-Acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic Acid, Sodium Salt
TRC-A158450-1G 1 g

4-Acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic Acid, Sodium Salt

Sign In for Pricing
View Details