Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus TNFSF15 protein

The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247) .

Product Specifications

Product Name Alternative

TL1A

Source

Yeast

Origin

Chicken

Purity

98%

Form

Lyophilized

Molecular Weight

19.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blender Bag, 400ml x 60µm, 300 x 180mm, pack of 500 (10 pack fo 50)
IPD4400-B400 1 Each

Blender Bag, 400ml x 60µm, 300 x 180mm, pack of 500 (10 pack fo 50)

Sign In for Pricing
View Details
STK39 Antibody
8C18954-AAT 50 µg

STK39 Antibody

Sign In for Pricing
View Details
Human ROGDI activation kit by CRISPRa
GA112510 1 Kit

Human ROGDI activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS633339 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
E-EL-H6296-01 24 Tests

Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit

Sign In for Pricing
View Details
Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit
E-EL-H6296-02 48 Tests

Human ENPP2 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 2) ELISA Kit

Sign In for Pricing
View Details