Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus TNFSF15 protein

The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247) .

Product Specifications

Product Name Alternative

TL1A

Source

Yeast

Origin

Chicken

Purity

98%

Form

Lyophilized

Molecular Weight

19.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K6PP Antibody
8C10836-AAT 50 µg

K6PP Antibody

Sign In for Pricing
View Details
CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL
BNC403442-100 1x 100 µL

CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gadd45g (NM_011817) Mouse Tagged ORF Clone
MG201228 10 µg

Gadd45g (NM_011817) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human S100A8 Antibody Pair Set
E-KAB-0519 50 µL & 100 µg

Human S100A8 Antibody Pair Set

Sign In for Pricing
View Details
Vmn1r202 Mouse Gene Knockout Kit (CRISPR)
KN518995 1 Kit

Vmn1r202 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Speer4a activation kit by CRISPRa
GA210300 1 Kit

Mouse Speer4a activation kit by CRISPRa

Sign In for Pricing
View Details