Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF protein

The Canine SCF Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF Biotinylated applications are for cell culture. Canine SCF Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Biotinylated Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

27.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)
More Discoveries

Explore Other Products

Browse additional items from our catalog

RSAD2 Peptide
orb2016649 100 µg

RSAD2 Peptide

Sign In for Pricing
View Details
diethyl 4-bromobutylphosphonate
T31444-01 10 mg

diethyl 4-bromobutylphosphonate

Sign In for Pricing
View Details
diethyl 4-bromobutylphosphonate
T31444-02 1 g

diethyl 4-bromobutylphosphonate

Sign In for Pricing
View Details
diethyl 4-bromobutylphosphonate
T31444-03 1 mg

diethyl 4-bromobutylphosphonate

Sign In for Pricing
View Details
diethyl 4-bromobutylphosphonate
T31444-04 50 mg

diethyl 4-bromobutylphosphonate

Sign In for Pricing
View Details
diethyl 4-bromobutylphosphonate
T31444-05 5 mg

diethyl 4-bromobutylphosphonate

Sign In for Pricing
View Details