Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF protein

The Canine SCF Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF Biotinylated applications are for cell culture. Canine SCF Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Biotinylated Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) .

Product Specifications

Product Name Alternative

Kit Ligand; Stem Cell Factor

Source

Yeast

Origin

Canine

Purity

98%

Form

Lyophilized

Molecular Weight

27.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)
More Discoveries

Explore Other Products

Browse additional items from our catalog

YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (AP)
MBS6364303-01 0.2 mL

YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (AP)

Sign In for Pricing
View Details
YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (AP)
MBS6364303-02 5x 0.2 mL

YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (AP)

Sign In for Pricing
View Details
Human Poly ADP Ribose Polymerase (PARP) ELISA Kit
RD-PARP-Hu-96Tests 96 Tests

Human Poly ADP Ribose Polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
FAM10A6 siRNA Oligos set (Human)
57308171 3x 5 nmol

FAM10A6 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human ZSCAN23 Knockout HEK293T cell line
GTR15417630 1 Vial

Human ZSCAN23 Knockout HEK293T cell line

Sign In for Pricing
View Details
PI4K2B Over-expression Lysate Product
GWB-60A5B7 0.1 mg

PI4K2B Over-expression Lysate Product

Sign In for Pricing
View Details