Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey CCL8 protein

The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77) ) (Gene ID: 102137164) .

Product Specifications

Source

Yeast

Origin

Monkey

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLK3 Adenovirus (Human)
16354052 1.0 mL

CLK3 Adenovirus (Human)

Sign In for Pricing
View Details
CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 405)
MBS6455144-01 0.1 mL

CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 405)

Sign In for Pricing
View Details
CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 405)
MBS6455144-02 5x 0.1 mL

CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 405)

Sign In for Pricing
View Details
Helicobacter Pylori Monoclonal Antibody
VAnt-Wyb645 Each

Helicobacter Pylori Monoclonal Antibody

Sign In for Pricing
View Details
MEF2A antibody - middle region (ARP38634_P050)
ARP38634_P050 100 µL

MEF2A antibody - middle region (ARP38634_P050)

Sign In for Pricing
View Details
DDX54 Lentiviral Activation Particles (h)
sc-407614-LAC 200 µL

DDX54 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details