Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey CCL8 protein

The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77) ) (Gene ID: 102137164) .

Product Specifications

Source

Yeast

Origin

Monkey

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSME3 (NM_176863) Human Over-expression Lysate
LH15484V 100 µg

PSME3 (NM_176863) Human Over-expression Lysate

Sign In for Pricing
View Details
Olr214 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV630769 1.0 µg DNA

Olr214 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Gtf2a2 (BC028551) Mouse Tagged ORF Clone Lentiviral Particle
MR200103L4V 200 µL

Gtf2a2 (BC028551) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal GCHFR Antibody (GCHFR/7731) [DyLight 488]
NBP3-26938G 0.1 mL

Mouse Monoclonal GCHFR Antibody (GCHFR/7731) [DyLight 488]

Sign In for Pricing
View Details
Mouse KH domain-containing protein 3 (KHDC3) ELISA Kit
abx529896 96 Tests

Mouse KH domain-containing protein 3 (KHDC3) ELISA Kit

Sign In for Pricing
View Details
H1N1 Puerto Rico Recombinant
32-13631-2 2 µg

H1N1 Puerto Rico Recombinant

Sign In for Pricing
View Details