Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey CCL8 protein

The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77) ) (Gene ID: 102137164) .

Product Specifications

Source

Yeast

Origin

Monkey

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzocaine BSA Conjugate
B2020815 1 mg

Benzocaine BSA Conjugate

Sign In for Pricing
View Details
Mouse Unc80 Pre-designed siRNA Set A
SI115700A 1 Each

Mouse Unc80 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ADCK4 AAV Vector (Human) (CMV)
11388102 1 µg

ADCK4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Znf536 3'UTR Luciferase Stable Cell Line
TU223907 1.0 mL

Znf536 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DFNA47 Recombinant Protein (Human)
RP054705 100 µg

DFNA47 Recombinant Protein (Human)

Sign In for Pricing
View Details
PDE7B Rabbit pAb
E45R18814N-100 100 µL

PDE7B Rabbit pAb

Sign In for Pricing
View Details