Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-16 protein

The Bovine IL-16 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 Biotinylated applications are for cell culture. Bovine IL-16 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Biotinylated Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130) ) (Gene ID: 506314) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

13.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM5A (NM_001042603) Human Recombinant Protein
TP710232 20 µg

KDM5A (NM_001042603) Human Recombinant Protein

Sign In for Pricing
View Details
Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-H0556-01 24 Tests

Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-H0556-02 48 Tests

Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-H0556-03 96 Tests

Human COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Recombinant PAK1 Antibody
RC-4521-01 50 μL

Recombinant PAK1 Antibody

Sign In for Pricing
View Details
Recombinant PAK1 Antibody
RC-4521-02 100 µL

Recombinant PAK1 Antibody

Sign In for Pricing
View Details