Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-16 protein

The Bovine IL-16 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 Biotinylated applications are for cell culture. Bovine IL-16 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Biotinylated Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130) ) (Gene ID: 506314) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

13.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFAP4 Mouse Monoclonal Antibody [Clone ID: AT12D11]
AM50053PU-N 100 µL

MFAP4 Mouse Monoclonal Antibody [Clone ID: AT12D11]

Sign In for Pricing
View Details
Fura -2 LR K+ Salt - calcium indicator
1062B 1 mg

Fura -2 LR K+ Salt - calcium indicator

Sign In for Pricing
View Details
Human CHEM Antibody Pair Set
E-KAB-0017 50 µL & 100 µg

Human CHEM Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS503278 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Human Small Breast Epithelial Mucin (SBEM) ELISA Kit
RD-SBEM-Hu-01 96 Tests

Human Small Breast Epithelial Mucin (SBEM) ELISA Kit

Sign In for Pricing
View Details
Human Small Breast Epithelial Mucin (SBEM) ELISA Kit
RD-SBEM-Hu-02 48 Tests

Human Small Breast Epithelial Mucin (SBEM) ELISA Kit

Sign In for Pricing
View Details