Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPCR, Rat (HEK293, His)

EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EPCR Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epcr-protein-rat-hek293-his.html

Purity

97.00

Smiles

NSDGSQSLHMLQISYFPDPYHGRHQGNASLGKLLTHTLEGPSNNVTILQLQDWQDPDSWARTESGLKIYLSQFNSLVQLIYRERKNDVVFPLTVSCSVGCELPPEEGSEPHVFFDVAVNGSAFVSFQPKTAIWVTGSQEPSEAINFTLKQLNTYNRTRYELQEFLQDTCVQYLENHITTQNTKGSQTGRSYTS

Molecular Formula

362248 (Gene_ID) Q4V8I1 (N21-S213) (Accession)

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tri-p-tolylamine-d21
T211066 10 mg

Tri-p-tolylamine-d21

Sign In for Pricing
View Details
Lentiviral mouse Med11 shRNA (UAS) - Lentiviral mouse Med11 shRNA (UAS, RFP) (25)
GTR15157895 1 Vial

Lentiviral mouse Med11 shRNA (UAS) - Lentiviral mouse Med11 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Striatin-4 (STRN4) ELISA Kit
orb1656771-01 48 Tests

Human Striatin-4 (STRN4) ELISA Kit

Sign In for Pricing
View Details
Human Striatin-4 (STRN4) ELISA Kit
orb1656771-02 96 Tests

Human Striatin-4 (STRN4) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) HFQ Polyclonal Antibody
MBS7177411 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) HFQ Polyclonal Antibody

Sign In for Pricing
View Details
MAFK Rabbit Polyclonal Antibody (Cy7)
orb1071763 100 µL

MAFK Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details