Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Classical swine fever virus Genome polyprotein, partial

Product Specifications

Abbreviation

Recombinant Classical swine fever virus Genome polyprotein, partial

UniProt

Q5U8X5

Expression Region

690-1028aa

Organism

Classical swine fever virus

Target Sequence

RLACKEDYRYALSSTNEIGLLGAGGLTTTWEEYSHDLQLNDGTVKAICVAGSFKVTALNVVSRRYLASLHKGALLTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRREKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGQVKQCKWCGFDFNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISAEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVRKTSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Acts as a cofactor for the NS3 protease activity. Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteasomal degradation. Packages viral RNA to form a viral nucleocapsid and thereby protects viral RNA. Plays also a role in transcription regulation. Protects the incoming virus against IFN-induced effectors. Plays a role in the regulation of viral RNA replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.7 kDa

References & Citations

Trans

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 Polyclonal Antibody
E55A03277 100 µg

AP2S1 Polyclonal Antibody

Sign In for Pricing
View Details
AmpR Antibody
orb808977 2 mg

AmpR Antibody

Sign In for Pricing
View Details
CBS Rabbit Polyclonal Antibody (HRP)
orb480391 100 µL

CBS Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
XRCC1 Polyclonal Antibody
MBS8525898-01 0.1 mg

XRCC1 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC1 Polyclonal Antibody
MBS8525898-02 0.1 mL (AF635)

XRCC1 Polyclonal Antibody

Sign In for Pricing
View Details
XRCC1 Polyclonal Antibody
MBS8525898-03 0.1 mL (AF610)

XRCC1 Polyclonal Antibody

Sign In for Pricing
View Details