Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL/TNFSF10, Mouse (His)

TRAIL/TNFSF10 protein binds to TNFRSF10A, TNFRSF10B, TNFRSF10C, TNFRSF10D, and possibly TNFRSF11B, inducing apoptosis.It can be modulated by decoy receptors TNFRSF10C, TNFRSF10D, and TNFRSF11B, which do not induce apoptosis.TRAIL/TNFSF10 exists as a homotrimer, interacting with its receptor monomers.This complex molecular interaction governs apoptotic signaling pathways.TRAIL/TNFSF10 Protein, Mouse (His) is the recombinant mouse-derived TRAIL/TNFSF10 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TRAIL/TNFSF10 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-tnfsf10-protein-mouse-his-solution.html

Purity

97.00

Smiles

PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Molecular Formula

22035 (Gene_ID) P50592 (P118-N291) (Accession)

Molecular Weight

Approximately 21.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL
BNC882177-100 1x 100 µL

DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680731-100 1x 100 µL

AMACR / p504S (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL
BNC472221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), Biotin conjugate, 0.1mg/mL
BNCB0965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details