Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA5/CD85f, Rat (HEK293, His)

The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LILRA5/CD85f Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilra5-cd85f-protein-rat-hek293-his.html

Purity

98.0

Smiles

QETSGLEGNPHKPTLSVQPGSLVARGKQVTILCEVTTGAQEYRLFKEGGPHPWRTKNTPKATNKAQFLISSIEQQHGGIYRCYYKTPSGWSEHSDPLELVVTGLYSKPSLSIQSSTVVTSGETVTLQCVSQLGFNRFVLTKEGEQKPSLIRDSEFINSTGQFQGLFPMGPVILSQRWMFRCYGYYVNSPQVWSEPSDLLEIHVSEAAQPLGLSPNISHPKTVSQHQDYTMEN

Molecular Formula

691533 (Gene_ID) NP_001070261.1 (Q17-N248) (Accession)

Molecular Weight

Approximately 33-40 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf55 AAV Vector (Human) (CMV)
14696101 1 µg

C7orf55 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Monobenzyl phthalate
HY-W011848-01 100 mg

Monobenzyl phthalate

Sign In for Pricing
View Details
Monobenzyl phthalate
HY-W011848-02 10 mM - 1 mL

Monobenzyl phthalate

Sign In for Pricing
View Details
Monobenzyl phthalate
HY-W011848-03 500 mg

Monobenzyl phthalate

Sign In for Pricing
View Details
Psg16 AAV siRNA Pooled Vector
37908166 1.0 µg

Psg16 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: U mLBI32]
E45M21782 100 µg

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: U mLBI32]

Sign In for Pricing
View Details