Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CCL20 protein

The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082) .

Product Specifications

Product Name Alternative

LARC

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.3 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDA (Cytidine Deaminase, Cytidine Aminohydrolase, CDD) (APC)
124718-APC 100 µL

CDA (Cytidine Deaminase, Cytidine Aminohydrolase, CDD) (APC)

Sign In for Pricing
View Details
Bullatine B
orb558840 20 mg

Bullatine B

Sign In for Pricing
View Details
Rotavirus Mouse Monoclonal Antibody [Clone ID: B196M]
AM05066PU-N 1 mg

Rotavirus Mouse Monoclonal Antibody [Clone ID: B196M]

Sign In for Pricing
View Details
USP20, CT (Ubiquitin Carboxyl-terminal Hydrolase 20, Ubiquitin Thiolesterase 20, Ubiquitin-specific-processing Protease 20, Deubiquitinating Enzyme 20, VHL-interacting Deubiquitinating Enzyme 2, hVDU2, KIAA1003, LSFR3A, VDU2) (Azide free) (HRP) discontinued
U4101-01B-HRP 200 µL

USP20, CT (Ubiquitin Carboxyl-terminal Hydrolase 20, Ubiquitin Thiolesterase 20, Ubiquitin-specific-processing Protease 20, Deubiquitinating Enzyme 20, VHL-interacting Deubiquitinating Enzyme 2, hVDU2, KIAA1003, LSFR3A, VDU2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Staphylococcal Protein A (SPA)
TRV-0048069-01 10 µg

Recombinant Staphylococcal Protein A (SPA)

Sign In for Pricing
View Details
Recombinant Staphylococcal Protein A (SPA)
TRV-0048069-02 50 µg

Recombinant Staphylococcal Protein A (SPA)

Sign In for Pricing
View Details