Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine CCL3L1 protein

The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459) .

Product Specifications

Product Name Alternative

LD78

Source

Yeast

Origin

Swine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-500 1x 500 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/982), CF640R conjugate, 0.1mg/mL
BNC400982-500 1x 500 µL

CD117 (KIT/982), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details