Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-13 protein

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2N Recombinant Antibody, PerCP Conjugated
bsm-61921R-PerCP-01 20 µL

UBE2N Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
UBE2N Recombinant Antibody, PerCP Conjugated
bsm-61921R-PerCP-02 100 µL

UBE2N Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lentiviral human SLC25A34 shRNA (UAS) - Lentiviral human SLC25A34 shRNA (UAS, GFP) (25)
GTR15121952 1 Vial

Lentiviral human SLC25A34 shRNA (UAS) - Lentiviral human SLC25A34 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FMOD AAV Vector (Rat) (CMV)
20703106 1 µg

FMOD AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Mouse Anti-PGK1 antibody
SLM-51374M-01 50 µL

Mouse Anti-PGK1 antibody

Sign In for Pricing
View Details
Mouse Anti-PGK1 antibody
SLM-51374M-02 100 µL

Mouse Anti-PGK1 antibody

Sign In for Pricing
View Details