Equine IL-13 protein

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113) .