Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-13 protein

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YEATS Domain-Containing Protein 2 (YEATS2) Antibody
abx457425-01 50 µg

YEATS Domain-Containing Protein 2 (YEATS2) Antibody

Sign In for Pricing
View Details
YEATS Domain-Containing Protein 2 (YEATS2) Antibody
abx457425-02 100 µg

YEATS Domain-Containing Protein 2 (YEATS2) Antibody

Sign In for Pricing
View Details
NXF3 Blocking Peptide
33R-8615 100 ug

NXF3 Blocking Peptide

Sign In for Pricing
View Details
SLC14A2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43885154 3x 1.0 µg DNA

SLC14A2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
2-Hydroxy-4-iodobenzonitrile
OR1005727 1 g

2-Hydroxy-4-iodobenzonitrile

Sign In for Pricing
View Details
SLP-76 (lymphocyte cytosolic protein 2, SH2 domain containing leukocyte protein of 76kD, Lymphocyte cytosolic protein 2, SH2 domain-containing leukocyte protein of 76kD, SLP76, SLP-76 tyrosine phosphoprotein) (AP) discontinued
S1014-20B-AP 100 µL

SLP-76 (lymphocyte cytosolic protein 2, SH2 domain containing leukocyte protein of 76kD, Lymphocyte cytosolic protein 2, SH2 domain-containing leukocyte protein of 76kD, SLP76, SLP-76 tyrosine phosphoprotein) (AP) discontinued

Sign In for Pricing
View Details