Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-8 protein

The Equine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79) ) (Gene ID: 100037400) .

Product Specifications

Product Name Alternative

CXCL8

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PANK3 Antibody (OTI3C4) [Alexa Fluor 488]
NBP2-73244AF488 0.1 mL

Mouse Monoclonal PANK3 Antibody (OTI3C4) [Alexa Fluor 488]

Sign In for Pricing
View Details
MDH1 Peptide (AAP48284)
AAP48284-100UG 100 µg

MDH1 Peptide (AAP48284)

Sign In for Pricing
View Details
SCUBE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2105505 3x 1.0 µg

SCUBE3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (PE)
MBS6307373-01 0.2 mL

HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (PE)

Sign In for Pricing
View Details
HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (PE)
MBS6307373-02 5x 0.2 mL

HMGXB3, ID (HMGXB3, KIAA0194, SMF, HMG domain-containing protein 3, HMG box-containing protein 3, Protein SMF) (PE)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PNO1 Polyclonal Antibody
MBS9006576 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) PNO1 Polyclonal Antibody

Sign In for Pricing
View Details