Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-8 protein

The Equine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79) ) (Gene ID: 100037400) .

Product Specifications

Product Name Alternative

CXCL8

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human VGF shRNA (UAS) - Lentiviral human VGF shRNA (UAS, GFP) (25)
GTR15333335 1 Vial

Lentiviral human VGF shRNA (UAS) - Lentiviral human VGF shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Ethyl 1- (aminomethyl) -3,3-dimethyl-2-oxabicyclo[2.1.1]hexane-4-carboxylate
APD13676-01 50 mg

Ethyl 1- (aminomethyl) -3,3-dimethyl-2-oxabicyclo[2.1.1]hexane-4-carboxylate

Sign In for Pricing
View Details
Ethyl 1- (aminomethyl) -3,3-dimethyl-2-oxabicyclo[2.1.1]hexane-4-carboxylate
APD13676-02 0.5 g

Ethyl 1- (aminomethyl) -3,3-dimethyl-2-oxabicyclo[2.1.1]hexane-4-carboxylate

Sign In for Pricing
View Details
ELISA kit for Rat Antithrombin III (AT III)
KTE100907-01 48 Tests

ELISA kit for Rat Antithrombin III (AT III)

Sign In for Pricing
View Details
ELISA kit for Rat Antithrombin III (AT III)
KTE100907-02 96 Tests

ELISA kit for Rat Antithrombin III (AT III)

Sign In for Pricing
View Details
ELISA kit for Rat Antithrombin III (AT III)
KTE100907-03 5x 96 Well

ELISA kit for Rat Antithrombin III (AT III)

Sign In for Pricing
View Details