Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 beta protein

The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251) .

Product Specifications

Product Name Alternative

IL-1F2

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.7 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARRDC1 (Center) Rabbit Polyclonal Antibody
AP50257PU-N 400 µL

ARRDC1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Poly(4-vinylpyridine), cross-linked
TRC-P689380-5G 5 g

Poly(4-vinylpyridine), cross-linked

Sign In for Pricing
View Details
Recombinant Mouse OMGP/OMG Protein (aa 1-245, His Tag)
PKSM040549 50 µg

Recombinant Mouse OMGP/OMG Protein (aa 1-245, His Tag)

Sign In for Pricing
View Details
MED14 (Center) Rabbit Polyclonal Antibody
AP52649PU-N 400 µL

MED14 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS640213 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF405S conjugate, 0.1mg/mL
BNC042720-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details