Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adiponectin/Acrp30, Mouse (227a.a)

Adiponectin/Acrp30 Protein, Mouse (227a.a) suppresses endothelial inflammatory response and vascular smooth muscle cell proliferation, as well as macrophage-to-foam cell transformation.

Product Specifications

Product Name Alternative

Adiponectin/Acrp30 Protein, Mouse (227a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adiponectin-acrp30-protein-mouse-227a-a.html

Purity

95.00

Smiles

VTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Molecular Formula

11450 (Gene_ID) Q60994 (V21-N247) (Accession)

Molecular Weight

Approximately 26 kDa

References & Citations

[1]Wilcox RA, et al. Provision of antigen and CD137 signaling breaks immunological ignorance, promoting regression of poorly immunogenic tumors. J Clin Invest. 2002 Mar;109 (5) :651-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AGBL3 knockdown cell line
ABC-KD0384 1 Vial

Human AGBL3 knockdown cell line

Sign In for Pricing
View Details
CAMK2β, His-tag, GST-tag
40041 10 µg

CAMK2β, His-tag, GST-tag

Sign In for Pricing
View Details
KSR1 Peptide - middle region
MBS3246442-01 0.1 mg

KSR1 Peptide - middle region

Sign In for Pricing
View Details
KSR1 Peptide - middle region
MBS3246442-02 5x 0.1 mg

KSR1 Peptide - middle region

Sign In for Pricing
View Details
Astell Load Sensed Timing
AUT4182 1 Each

Astell Load Sensed Timing

Sign In for Pricing
View Details
CMA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-54265R-BF488-TR 20 µL

CMA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details