Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syntenin-1, Human (N-His)

Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Syntenin-1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syntenin-1-protein-human.html

Purity

96.40

Smiles

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Molecular Formula

6386 (Gene_ID) NP_001007068.1 (M1-V298) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG1 Fluorescein Isotype Control (Clone 43414)
IC005F 200 Tests

Rat IgG1 Fluorescein Isotype Control (Clone 43414)

Sign In for Pricing
View Details
KLK5 Protein Lysate
OCOA15437-20UG 20 µg

KLK5 Protein Lysate

Sign In for Pricing
View Details
UHRF1 Rabbit pAb
A2343-01 20 µL

UHRF1 Rabbit pAb

Sign In for Pricing
View Details
UHRF1 Rabbit pAb
A2343-02 100 μL

UHRF1 Rabbit pAb

Sign In for Pricing
View Details
UHRF1 Rabbit pAb
A2343-03 500 μL

UHRF1 Rabbit pAb

Sign In for Pricing
View Details
UHRF1 Rabbit pAb
A2343-04 1000 μL

UHRF1 Rabbit pAb

Sign In for Pricing
View Details