Syntenin-1, Human (N-His)
Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Syntenin-1 Protein, Human (N-His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/syntenin-1-protein-human.html
Purity
96.40
Smiles
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Molecular Formula
6386 (Gene_ID) NP_001007068.1 (M1-V298) (Accession)
Molecular Weight
Approximately 32 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041870-500 1x 500 µL
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402818-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC810018-500 1x 500 µL
Human Kappa Light Chain (L1C1), CF680R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681761-500 1x 500 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details