Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syntenin-1, Human (N-His)

Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Syntenin-1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syntenin-1-protein-human.html

Purity

96.40

Smiles

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Molecular Formula

6386 (Gene_ID) NP_001007068.1 (M1-V298) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDZD8 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb880476 100 µL

PDZD8 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Recombinant Human TRAM1 Protein, N-His-KSI
AP98455 50 µg

Recombinant Human TRAM1 Protein, N-His-KSI

Sign In for Pricing
View Details
GPR35 Antibody
DF4973-01 100 µL

GPR35 Antibody

Sign In for Pricing
View Details
GPR35 Antibody
DF4973-02 200 µL

GPR35 Antibody

Sign In for Pricing
View Details
RPS19BP1 Rabbit Polyclonal Antibody (HRP)
orb2719544 100 µg

RPS19BP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human COG2 Pre-designed siRNA Set A
SI003374A 1 Each

Human COG2 Pre-designed siRNA Set A

Sign In for Pricing
View Details