Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AL1 (OR5AL1)

Product Specifications

Product Name Alternative

Olfactory receptor OR11-184

Abbreviation

Recombinant Human OR5AL1 protein

Gene Name

OR5AL1

UniProt

P0C617

Expression Region

1-328aa

Organism

Homo sapiens (Human)

Target Sequence

MCALKGFLEENFYTYSVAKGNHSTVYEFILLGLTDNAELQVTLFGIFLVVYLASFMGNFGLIMLIQISPQLHTPMYFFLSHLAFVDFSFTSSVAPNTLVNFLCEVKSITFYACAIQVCCFITFVVCELYLLSIMAYDRYVAICNPLLYVILIPRKCIKLIASTYVYGFTVGLVQTVATSYLSFCDSNVINHFYHDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVLISYGFIFFAILRIHSAEGRQKAFSTSASHLTSITIFYGTIIFMYPQPKSSHSLNMDKVASVFNVVVIPTLNPLIYSLRNQEVKNALKRIIEKLCLAVK

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

House dust - Greer Labs Inc. Allergen
50-51 1 Each

House dust - Greer Labs Inc. Allergen

Sign In for Pricing
View Details
TFPI2 (Tissue Factor Pathway Inhibitor 2, TFPI-2, Placental Protein 5, PP5, FLJ21164) (FITC)
134375-FITC 100 µL

TFPI2 (Tissue Factor Pathway Inhibitor 2, TFPI-2, Placental Protein 5, PP5, FLJ21164) (FITC)

Sign In for Pricing
View Details
SETD7 Antibody, HRP conjugated
A63489-50UG 50 µg

SETD7 Antibody, HRP conjugated

Sign In for Pricing
View Details
TTTY11 sgRNA CRISPR Lentivector set (Human)
K2555201 3x 1.0 µg

TTTY11 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Bovine Alpha Enolase Antibody IgM (AE-IgM) ELISA Kit
MBS9358180-01 48 Well

Bovine Alpha Enolase Antibody IgM (AE-IgM) ELISA Kit

Sign In for Pricing
View Details
Bovine Alpha Enolase Antibody IgM (AE-IgM) ELISA Kit
MBS9358180-02 96 Well

Bovine Alpha Enolase Antibody IgM (AE-IgM) ELISA Kit

Sign In for Pricing
View Details