Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD69, Human (HEK293, His)

CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

CD69 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd69-protein-human-hek-293-his.html

Purity

95.0

Smiles

GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Molecular Formula

969 (Gene_ID) Q07108 (G64-K199) (Accession)

Molecular Weight

18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homocysteine Assay Kit
abx098434 96 Tests

Homocysteine Assay Kit

Sign In for Pricing
View Details
PUS1 ORF Vector (Human) (pORF)
ORF028591 1.0 µg DNA

PUS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human IgG (gamma chain) Antibody Texas Red Conjugated
orb347318 1 mg

Human IgG (gamma chain) Antibody Texas Red Conjugated

Sign In for Pricing
View Details
Metrnl (NM_001014104) Rat Untagged Clone
RN204359 10 µg

Metrnl (NM_001014104) Rat Untagged Clone

Sign In for Pricing
View Details
Pdk1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6937903 1.0 µg DNA

Pdk1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
pAL149  Plasmid
PVT17520 2 µg

pAL149 Plasmid

Sign In for Pricing
View Details