Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRF Human Rat peptide

CRF Human Rat peptide

Product Specifications

Product Name Alternative

Corticoliberin, Corticorelin, CRF-41, CRH

Source

Synthetic

Purity

> 95%

Form

Lyophilized powder

Molecular Weight

4575.5

Storage Conditions

Shipped at 4°C. Store at -20°C for one year.

Notes

For research use only.

Applications Notes

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

AA Sequence

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit
MBS9332095-01 48 Well

Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit

Sign In for Pricing
View Details
Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit
MBS9332095-02 96 Well

Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit

Sign In for Pricing
View Details
Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit
MBS9332095-03 5x 96 Well

Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit

Sign In for Pricing
View Details
Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit
MBS9332095-04 10x 96 Well

Mouse Down syndrome cell adhesion molecule-like protein 1, DSCAML1 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-EIF6 Antibody
DL96810A-01 50 µL

Rabbit anti-EIF6 Antibody

Sign In for Pricing
View Details
Rabbit anti-EIF6 Antibody
DL96810A-02 100 µL

Rabbit anti-EIF6 Antibody

Sign In for Pricing
View Details