What is the catalog number for CRF Human Rat peptide?

The catalog number for CRF Human Rat peptide is orb216549.

What sizes are available for CRF Human Rat peptide?

CRF Human Rat peptide is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does CRF Human Rat peptide come in?

CRF Human Rat peptide is available in 3 different pack sizes.

Is CRF Human Rat peptide in stock?

CRF Human Rat peptide is currently made to order / not held in immediate stock. Contact us for lead time.

CRF Human Rat peptide

Product Specifications

Product Name Alternative

Corticoliberin, Corticorelin, CRF-41, CRH

Source

Synthetic

Purity

> 95%

Form

Lyophilized powder

Molecular Weight

4575.5

Storage Conditions

Shipped at 4°C. Store at -20°C for one year.

Notes

For research use only.

Applications Notes

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

AA Sequence

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2