Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H4, Human (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B7-H4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h4-protein-human-hek293-his.html

Purity

98.80

Smiles

FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Molecular Formula

79679 (Gene_ID) Q7Z7D3-1 (F29-A258) (Accession)

Molecular Weight

Approximately 43-48 kDa of the apparent molecular mass.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Veratrole 98% For Synthesis
02827 00100 100 mL

Veratrole 98% For Synthesis

Sign In for Pricing
View Details
Human TIE2 Matched Antibody Pair Set [ABP-S-02777]
ABP-S-02777 5 Plates

Human TIE2 Matched Antibody Pair Set [ABP-S-02777]

Sign In for Pricing
View Details
ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (MaxLight 650)
MBS6220730-01 0.1 mL

ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (MaxLight 650)

Sign In for Pricing
View Details
ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (MaxLight 650)
MBS6220730-02 5x 0.1 mL

ACOT9 (Acyl CoA Thioester Hydrolase 9, Acyl Coenzyme A Thioesterase 9, Acyl CoA Thioesterase 9, ACATE2, CGI-16, MT-ACT48) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal ACY3 Antibody [DyLight 488]
NBP3-21422G 0.1 mL

Rabbit Polyclonal ACY3 Antibody [DyLight 488]

Sign In for Pricing
View Details
Anti-Tubby protein homolog Antibody (3G215)
MF-0091513-01 50 µL

Anti-Tubby protein homolog Antibody (3G215)

Sign In for Pricing
View Details