Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSK-3 beta, Mouse (sf9, His)

GSK-3 beta is a protein kinase that regulates cellular circadian rhythm, autophagy, and apoptosis. GSK-3 beta Protein, Mouse (sf9, His) is the recombinant mouse-derived GSK-3 beta protein, expressed by Sf9 insect cells , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

GSK-3 beta Protein, Mouse (sf9, His), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gsk-3-beta-protein-mouse-sf9-his.html

Purity

95.00

Smiles

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Molecular Formula

56637 (Gene_ID) Q9WV60 (M1-T420) (Accession)

Molecular Weight

Approximately 47-48 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMNL2 (G-8) : m-IgG2b BP-HRP Bundle
sc-548618 1 Kit

FMNL2 (G-8) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
CDK5RAP2 (NM_001011649) Human Tagged ORF Clone
RG224233 10 µg

CDK5RAP2 (NM_001011649) Human Tagged ORF Clone

Sign In for Pricing
View Details
CDC2 (CDK1), CT (CDK1, CDC2, CDC28A, CDKN1, P34CDC2, Cyclin-dependent kinase 1, Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase) (MaxLight 750) discontinued
033568-ML750 100 µL

CDC2 (CDK1), CT (CDK1, CDC2, CDC28A, CDKN1, P34CDC2, Cyclin-dependent kinase 1, Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GATA5 Antibody, Biotin conjugated
CSB-PA883616HD01HU-01 50 µg

GATA5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GATA5 Antibody, Biotin conjugated
CSB-PA883616HD01HU-02 100 µg

GATA5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MERTK Antibody
orb2672020-01 50 µL

MERTK Antibody

Sign In for Pricing
View Details