Recombinant CXCL1 (C-C motif chemokine ligand 1), Mouse, Animal-Free

GRO-α: MGSAα, NAP-3, GRO1, KC (murine)

Mouse

His-tag at the N-terminus

Escherichia coli

Mouse

Immunology & Inflammation

<0.1 EU per 1 μg of the protein by the LAL method.

>95% as determined by SDS-PAGE. Ni-NTA chromatography.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <15 ng/mL.

Lyophilized

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

For research use only.

Cell Culture, ELISA

The protein was lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.

14825