Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Charged multivesicular body protein 2b (CHMP2B)

Product Specifications

Product Name Alternative

CHMP2.5; Chromatin-modifying protein 2b; CHMP2b; Vacuolar protein sorting-associated protein 2-2; Vps2-2; hVps2-2

Abbreviation

Recombinant Human CHMP2B protein

Gene Name

CHMP2B

UniProt

Q9UQN3

Expression Region

2-213aa

Organism

Homo sapiens (Human)

Target Sequence

ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses) . ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF126 (Biotin)
574944-01 50 µg

RNF126 (Biotin)

Sign In for Pricing
View Details
RNF126 (Biotin)
574944-02 100 µg

RNF126 (Biotin)

Sign In for Pricing
View Details
Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit
MBS7259323-01 48 Well

Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit
MBS7259323-02 96 Well

Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit
MBS7259323-03 5x 96 Well

Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit
MBS7259323-04 10x 96 Well

Goat Olfactory Receptor 2A4 (OR2A4) ELISA Kit

Sign In for Pricing
View Details