What is the catalog number for Cecropin A?

The catalog number for Cecropin A is orb1147115.

What sizes are available for Cecropin A?

Cecropin A is available in the following size(s): 1 mg.

Is Cecropin A in stock?

Cecropin A is currently made to order / not held in immediate stock. Contact us for lead time.

Cecropin A

Broad spectrum insect antimicrobial; Antibacterial; Antifungal; Antimicrobial peptides.

Product Specifications

Product Name Alternative

80451-04-3AM080 , AMP, CeA, CeA), Cecropin A, H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, Hyalophora cecropia, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, antimicrobial peptide, moths

Field of Research

Microbiology

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4003.8 Da

Storage Conditions

Store desiccated, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2